<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
50164762 50164762 Uganda 2012 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, E35D, M36I, R41K, R57K, L63I, H69K, L89M  
>50164762| codons 12-99
TVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIIIEICGKKA
IGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, K49R, T69TA, K122E, D123S, I135T, I142V, K173S, Q174K, D177E, Q207A, R211S E29D
>50164762| codons 1-231
PISPIETVPVTLKPGMDGPKVKQWPLTEDKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSAKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMG

References
Author Title Citation
Ndase, P Outside sexual partnerships and risk of HIV acquisition for HIV uninfected partners in African HIV serodiscordant partnerships. JAIDS, 2012