<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ARMA159 ARMA159 Argentina 1999 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I15V, E35D, M36I, R41K, R57K, Q61N, I62V, V77I, I93L  
>ARMA159| codons 1-99
PQITLWQRPLVIIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NVLIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122E, D123A, S134C, I135V, I142T, A272P, K281R, E297K, I329V, Y342F, Q394L, E399D, A400T, K431T, V435A, G436E, A446S, R448K, L452K, R461K, D471E, T477A, Q480H, H483Y, L491S, A534S, I556V, V559I  
>ARMA159| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEAFRKYTAFTIPCVNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIFQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPILKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAEAETFYVDGASNKETKKGKAGYVTDKGRQKVVSLTETTNQKAELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGVRKIL

References
Author Title Citation
Carr, JK Diverse BF recombinants have spread widely since the introduction of HIV-1 into South America. AIDS, 2001