<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VN-2-051 VN-2-051 Vietnam 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y   K103N V179E E6D, K11T, V35T, T39K, K43E, S68SG, K122E, D123S, I135L, E138Q, S162C, Q174R, D177E, I178M, T200A, Q207S, R211A, K238R, V245E  
>VN-2-051| codons 4-250
PIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPVFAI
KKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDES
FRKYTAFTIPSLNNQTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKRNPEMEIYQY
VDDLYVGSDLEIGQHRAKIEELRSHLLAWGFYTPDKKHQKEPPFLWMGYELHPDRWTVQP
IELPEKD

References
Author Title Citation
Aghokeng, AF Extraordinary heterogeneity of virological outcomes in patients receiving highly antiretroviral therapy and monitored with the World Health Organization public health approach in sub-saharan Africa and southeast Asia. Clin Infect Dis, 2014