<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TG-3-137 TG-3-137 Togo 2009 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, G190A   V35T, V60I, D121H, K122E, I135V, I142V, T165L, K173T, Q174K, D177E, T200A, Q207D, R211K, V245Q, E248D, D250E, A272P, V276I, E291D, V292I, I293V, D324E, I329V, Q334L, G335D, F346Y, R356K, M357K, R358G, G359S, K366R, T377Q, V381I, T386V, Q394R, E399D, A400I, E404D, E413D, Q428R  
>TG-3-137| codons 1-429
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMLKILEPFRTKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQGLDQWTYQIYQEPYKNLKTGKYAKKGSA
HTNDVRQLTEAVQKIAQESIIIWGKVPKFKLPIRKETWDIWWTDYWQATWIPDWEFVNTP
PLVKLWYRL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, R57K, L63P, C67E, H69K, V82I, L89M E35H
>TG-3-137| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEHINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Aghokeng, AF Extraordinary heterogeneity of virological outcomes in patients receiving highly antiretroviral therapy and monitored with the World Health Organization public health approach in sub-saharan Africa and southeast Asia. Clin Infect Dis, 2014