<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TG-2-417 TG-2-417 Togo 2010 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184IV   Y181C V108I, V179E K20R, K22R, V35T, T39A, E40D, K122P, D123E, I135V, S162A, K173T, Q174K, D177E, Q197QL, T200A, Q207E, F214FL, V245Q, A272P, K277Q, Q278K, K281R, T286A, E291D, V292I, I293V, P294T, S322T, I326V, G335D, R356K, M357R, G359S, A371V, I375V, T377L, K390R, A400T, T403M, E432D  
>TG-2-417| codons 1-432
PISPIETVPVKLKPGMDGPRVRQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DPEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIEI
CQYVDDLYVGSDLEIGLHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVQKLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDVKQLTEVVQKVALESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15IV, L19P, K20I, M36I, R41K, L63T, H69HKNQ, K70R, V82I, L89M  
>TG-2-417| codons 1-99
PQITLWQRPIVTVKVGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Aghokeng, AF Extraordinary heterogeneity of virological outcomes in patients receiving highly antiretroviral therapy and monitored with the World Health Organization public health approach in sub-saharan Africa and southeast Asia. Clin Infect Dis, 2014