<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ARMA070 ARMA070 Argentina 1999 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G48R I15V, G16E, E35D, M36I, R41K, R57K, Q61N, L63T, E65D, I72T G51R, G94S
>ARMA070| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIRGIRGFIKVKQYD
NITIDICGHKATGTVLVGPTPVNIIGRNLLTQISCTLNF

References
Author Title Citation
Carr, JK Diverse BF recombinants have spread widely since the introduction of HIV-1 into South America. AIDS, 2001