<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TG-2-552 TG-2-552 Togo 2010 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V N348I K103N V108I V35T, E36D, K122P, I135V, S162A, K173T, Q174E, D177E, T200A, Q207E, P243T, V245Q, E248D, T286A, E291D, V292I, I293V, P294T, S322T, I326V, G335D, R356K, M357K, G359S, A371V, I375V, A376S, K390R, E396D, T403M, E432D, V435I  
>TG-2-552| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKILKTGKYAKKRSA
HTNDVKQLTEVVQKVSTESIVIWGKTPKFRLPIQKDTWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K20I, M36I, R41K, I64IM, H69K, L89M  
>TG-2-552| codons 1-99
PQITLWQRPLVTAKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Aghokeng, AF Extraordinary heterogeneity of virological outcomes in patients receiving highly antiretroviral therapy and monitored with the World Health Organization public health approach in sub-saharan Africa and southeast Asia. Clin Infect Dis, 2014