<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TG-1-487 TG-1-487 Togo 2011 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219Q, N348I V106A V108I, F227L V35T, E36D, D121H, K122E, I135V, S162A, Q174E, D177E, T200A, E203D, Q207E, R211K, L228R, P243T, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, P294T, S322T, G335D, R356K, M357K, G359S, A371V, I375V, K390R, A400T, T403M, E432D S105I
>TG-1-487| codons 1-433
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKIATILDVGDAYFSVPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKENPEIVI
YQYVDDLYVGSDLEIGQHRAKIDELREHLLKWGFTTPDQKHQKEPPLRWMGYELHPDKWT
VQTIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQDQWTYQIYQEPFKILKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19P, K20I, M36I, R41K, Q61N, C67Y, H69K, K70R, L89I  
>TG-1-487| codons 1-99
PQITLWQRPIVTVKIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
NILIEIYGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

References
Author Title Citation
Aghokeng, AF Extraordinary heterogeneity of virological outcomes in patients receiving highly antiretroviral therapy and monitored with the World Health Organization public health approach in sub-saharan Africa and southeast Asia. Clin Infect Dis, 2014