<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
URTR17 URTR17 Uruguay 1999 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63S, I72T  
>URTR17| codons 1-99
PQITLWQRPLVSIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NISIEICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, I135V, S162C, E204D, V245E, A272P, I274V, K277R, K281R, V292I, E297K, P321S, Q334H, G359S, A376T, K385R, K390R, E399D, A400T, E413D, K431T, V435A, A446S, L452K, V466A, T470A, D471E, T477A, Q480H, H483Q, L491P, S519N, V531I, A534S, V559I  
>URTR17| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEDLRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGVKVRQLCRLLRGTKALTEIIPLTKEAE
LELAENREILKEPVHGVYYDSSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKITTESIVIWGRTPKFRLPIQKETWDTWWTEYWQATWIPDWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKKGKAGYVTDRGRQKAVSLAETTNQKAELH
AIQLALQDSGPEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKIYLSWVPAHK
GIGGNEQVDKLVSAGIRKIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  S153Y S17N, I72V, I84L, L101I, S119T, T124A, T125A, K136Q, V201I, A205S, K211R, K215N, T218I, L234V, D256E S283G
>URTR17| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVEYMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQNQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Carr, JK Diverse BF recombinants have spread widely since the introduction of HIV-1 into South America. AIDS, 2001