<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TG-4-642 TG-4-642 Togo 2011 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219KQ, N348IT Y181C V108I V35K, E36D, K49R, V60I, K64KR, K102Q, K122E, D123N, I135V, T139I, S162A, E169D, K173T, Q174K, D177E, T200A, R211K, F214L, H221Y, V245Q, D250DG, K281R, T286A, E291D, I293V, P294T, S322T, I326V, A327V, G335D, F346L, R356K, M357R, G359S, A371L, I375V, A376S, T377V, K390R, A400T  
>TG-4-642| codons 1-405
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKDICTEMEKEGKISRIGPENPYNTPI
FAIRKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSVNNEIPGIRYQYNVLPQGWKGSPAIFQASMTKILDPFRTKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPDQKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKGSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVVEIQKQGQDQWTYQIYQEPLKTLKTGKYAKRRSA
HTNDVKQLTELVQKVSVESIVIWGKTPKFRLPIQKETWETWWTEY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19P, K20I, E35D, M36I, R41RK, H69K, K70R, L89M  
>TG-4-642| codons 1-99
PQITLWQRPIVTVKIGGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Aghokeng, AF Extraordinary heterogeneity of virological outcomes in patients receiving highly antiretroviral therapy and monitored with the World Health Organization public health approach in sub-saharan Africa and southeast Asia. Clin Infect Dis, 2014