<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TG-1-472 TG-1-472 Togo 2010 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V N348NI K101KE, G190A   K20R, V35T, V60I, T69S, D121H, K122E, I135T, K173L, Q174K, D177E, I178M, T200A, Q207E, R211K, V245Q, E248D, D250E, A272P, K277R, Q278H, T286A, E291D, I293V, E297T, L301M, I326V, Q334L, G335GD, F346Y, R356K, M357R, R358G, G359S, V365I, T386V, I393IM, Q394R, A400T  
>TG-1-472| codons 1-429
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEMVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGAKALTDVVPLTTEAE
MELAENREILKEPVHGVYYDPSKDLVAEIQKQGLDQWTYQIYQEPYKILKTGKYAKRGSA
HTNDIKQLTEAVQKIATESIVIWGKVPKFKLPMRKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, L19P, K20I, E35D, M36I, R41K, R57K, Q61K, C67S, H69K, V82I, L89M  
>TG-1-472| codons 1-99
PQITLWQRPIVTVKIEGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
KILIEISGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Aghokeng, AF Extraordinary heterogeneity of virological outcomes in patients receiving highly antiretroviral therapy and monitored with the World Health Organization public health approach in sub-saharan Africa and southeast Asia. Clin Infect Dis, 2014