<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM53392 CM53392 Cameroon 1997 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10I, T12K, I13V, K20I, M36L, N37S, R41K, L63P, C67Y, H69K, K70R, L89I  
>CM53392| codons 1-99
PQITLWQRPIIKVKIGGQLIEALLDTGADDTVLEELSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEIYGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11S, V35T, T39N, E40D, V60I, K104R, K122E, D123S, I135T, T165I, K173A, D177E, T200A, Q207K, R211K, V245Q, K281R, E291D, V292I, I293V, P294T, E297K, S322G, D324E, Q334D, G335D, R356K, M357R, G359S, K366R, A371V, K374R, I375V, A376T, K390R, K395R, A400T, T403M, V435E, D471E, Q480H, H483Y, G490E, L491T, E492K, K512R, L517V, S519N, Q524K, K527E, A534S, A554S  
>CM53392| codons 1-560
PISPIETVPVSLKPGMDGPKVKQWPLTEEKIKALTEICNDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKALTDIVTLTKEAE
LELAENREILKEPVHGVYYDPGKELIAEIQKQGDDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDVRQLTEVVQRVTTESIVIWGKTPKFRLPIQRETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIYLALQDSETKVNIVTDSQYALGIIQAQPDRSESEVVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, S17T, A23V, S24N, V31I, I72V, T112V, I113V, T124A, T125A, G134N, I135V, D167E, V201I, T206S, L234I S283G
>CM53392| codons 1-288
FLDGIDKAQEDHERYHTNWRAMVNDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWANVKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Carr, JK The AG recombinant IbNG and novel strains of group M HIV-1 are common in Cameroon. Virology, 2001