<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M1418817 M1418817 Austria 2014 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, K14R, I15V, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, L89M, I93L  
>M1418817| codons 4-99
TLWQRPVVTIRVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIT
IDICGHKATGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, E40D, V60I, K122E, I135T, I142V, S162F, Q174E, D177E, I195L, G196E, T200A, Q207T, R211K, V245Q  
>M1418817| codons 38-247
CADMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQFSMTKILEPFRKENPEIVIYQYMDDLYVGSDLELEQHRAKIEELRTHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Hoenigl, M Characterization of HIV transmission in south-east Austria. PLoS ONE, 2016