<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1317 CA35534 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 3TC+ AZT+ DDI NA
3 None 3
4 D4T+ DDI+ IDV 53
5 3TC+ AZT+ SQV 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S, L90M L10F I15V, E35D, M36I, R41K, R57K, I62V, L63P, C67Y, I93L K20AT
>CA35534| codons 1-99
PQITLWQRPFVTIKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVPIEIYGHKAIGTVLVGPTPVNIIGRSLMTQLGCTLNF

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005