Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1317 | CA35534 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDI | NA |
| 2 | 3TC+ AZT+ DDI | NA |
| 3 | None | 3 |
| 4 | D4T+ DDI+ IDV | 53 |
| 5 | 3TC+ AZT+ SQV | 37 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| N88S, L90M | L10F | I15V, K20AT, E35D, M36I, R41K, R57K, I62V, L63P, C67Y, I93L |
| >CA35534| codons 1-99 PQITLWQRPFVTIKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD QVPIEIYGHKAIGTVLVGPTPVNIIGRSLMTQLGCTLNF |
References
| Author | Title | Citation |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |