<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4899 CA35528 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 52
2 SQV+ D4T+ 3TC 120
3 IDV+ D4T+ DDI 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73C L10I, K20I, L63Q, I64V, I72T, T74S, V77I, I93L  
>CA35528| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIQVEICGHKATCSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K102R, K104R, K122E, I142V, Q151X, K173N, Q174K, T200A, Q207E, R211K, D250E, A272P  
>CA35529| codons 1-280
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPXGWKGSPAIFQSSMTKILEPFRNKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLC

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005