<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR71 DR71 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 RTV+ DDI+ D4T 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D       V35T, E36A, T39E, S48T, K122E, D123G, K173T, Q174K, T200A, Q207E, V245Q, A272P, K275R, Q278H, T286TA, E291D, V292I, I293V, D324E  
>DR71| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, V82A M46MV I15IV, G16E, L19I, M36I, R41K, Q61H, L63A, E65D, H69K, I72V, L89M, I93L  
>DR71| codons 1-99
PQITLWQRPLVTIKVEGQIKEALLDTGADDTILEEINLPGKWKPKVIGGIGGFIKVRQYD
HIAIDICGKKAVGTVLVGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008