<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR68 DR68 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ RTV 104

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   L10V, T12S, I15V, L19I, E35ED, M36I, R41K, D60E, Q61E, L63P, H69K, L89M, I93L  
>DR68| codons 1-99
PQITLWQRPVVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVRQYE
EIPIEICGKKAIGTVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, Q151M, M184V A62V, V75I, F77L, F116Y     V35T, T39EK, E40EK, S48T, S68G, T69TI, K122E, D123S, S162C, K166KR, K173T, Q174K, I178IL, G196E, T200A, I202IV, Q207E, F214L, V245Q, E248D, A272P, E291D, V292VI, I293V, E297K E194AT
>DR68| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEKMEKEGKITKIGPENPYNTPV
FVIKRKDGIKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQCSMTRILEPFRTKNPDLVI
YQYVDDLYVGSDLAIEQHRAKVEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008