<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR61 DR61 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA
2 D4T+ DDI+ NFV+ RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VL, L90LM   T12TS, I13IV, I15V, L19M, K20R, M36I, N37D, R41K, H69K, L89M, I93L  
>DR61| codons 1-99
PQITLWQRPLVSVKVGGQMREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPLNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML       V35T, E36A, T39E, S48T, W88WC, K122E, D123DG, I135IV, K166R, K173A, Q174K, D177E, G196R, T200V, Q207D, T215X, V245Q, D250N, A272P, K277R, T286A, E291D, V292I  
>DR61| codons 1-309
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEELEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAKNPEIVI
YQYMDDLYVGSDLEIRQHRVKIEELRDHLLRWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKNSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIIPLTEEAE
LELAENREI

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008