<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR56 DR56 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA
2 EFV+ D4T+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    L100LI, K103N   S3I, E28K, K32E, V35T, E36A, T39E, S48T, T69TN, L74X, K101X, K122E, D123N, I135L, K173A, Q174K, D177E, T200A, Q207E, R211RK, V245Q, E248DN, S251C, A272P, K277R, T286A, E291D, V292I, Q334D  
>DR56| codons 1-335
PIIPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSNKWRKXVDFRELNKRTQDFWEVQLGIPHPAGIXKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDCWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGDG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5F, T12S, I15V, L19I, M36I, R41K, Q61E, L63X, H69K, T74S, L89M, I93L  
>DR56| codons 1-99
PQITFWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EIXIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008