<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR54 DR54 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NFV NA
2 RTV+ AZT+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       S3SC, V35T, E36A, T39E, S48T, E53D, K122E, D123G, I135IT, S162SC, K173A, D177E, I178L, T200A, Q207E, R211K, F214L, V245Q, A272P, K277R, E291D, V292I, I293V, S322A, D324E P1PA
>DR54| codons 1-333
AICPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAQNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPAKELIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, M36L, R41K, L63T, H69K, T74S, L89M, I93L, F99FL  
>DR54| codons 1-99
PQITLWQRPLVTIKIGGQTKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNL

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008