<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR41 DR41 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI NA
2 AZT+ 3TC+ NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, I15V, M36I, R41K, Q61E, L63V, H69K, L89M, I93L  
>DR41| codons 1-99
PQITLWQRPIVSIKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y K219KN Y181C, M230L A98G T39D, E44D, S48T, K122E, D123S, S162C, I167V, K173A, D177DE, T200A, Q207E, L228H, Q242H, V245Q, P247A, K249Q, A272P, K275Q, Q278H, T286A, E291D, V292I, I293V, Q334X  
>DR41| codons 37-334
ICDELEKDGKITKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPH
PGGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PAIFQCSMTKVLEPFRAQNPEIVICQYVDDLYVGSDLEIGQHRAKIEELREHLWRWGFYT
PDNKHQKEPPFHWLGYELHPDKWTVHPIQLAEQDSWTVNDIQKLVGKLNWASQIYPGIQV
KHLCKLLRGAKALTDIVPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGX

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008