<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR37 DR37 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ AZT+ DDI NA
2 NFV+ DDI+ ABC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74IV, M184V K219KE     V35M, T39D, S48T, V60VI, D123DN, K173A, Q174K, T200A, E203K, Q207E, R211K, V245Q, K249KQ, D250E, A272P, K277R, E291D, V292I, I293V  
>DR37| codons 1-309
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICDEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLLKWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPEQESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S, L90M L10F T12S, I13V, I15V, L19I, K20T, M36I, R41K, L63P, H69K, L89I, I93L  
>DR37| codons 1-99
PQITLWQRPFVSVKVGGQITEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRSIMTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008