<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR36 DR36 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 MKC442+ DDI+ D4T NA
2 3TC+ AZT+ NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219EQ K101KE, G190A   V35T, T39E, S48T, K122E, D123N, I135T, K173T, D177E, T200A, E203K, Q207E, D250DE, A272P, K277R, V292*, I293L, L325I  
>DR36| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYVDDLYVASDLEIGQHRAKIKELREHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTE*LPLTEEAE
LELAENREILKEPVHGVYYDPSKDIIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15X, L19I, E35D, M36I, R41K, H69K, T74S, L89M, I93L  
>DR36| codons 1-99
PQITLWQRPLVTIKXGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008