<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DR10 DR10 South Africa 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT NA
2 3TC+ D4T+ EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184I, L210W, T215Y   Y188L, G190A A98G K20R, V35T, T39E, E44D, S48T, V60I, V118I, K122E, D123G, K166R, K173A, D177E, T200A, Q207E, H208HY, R211K, V245Q, A272P, K277R, L279M, T286A, E291D, V292I, I293V  
>DR10| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICEELEKDGKITKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPEIVI
YQYIDDLLVASDLEIGQHRAKIEELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQMCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15IV, L19IT, K20R, M36I, R41K, Q61E, L63P, H69K, L89M, I93L  
>DR10| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Pillay, V HIV type 1 subtype C drug resistance among pediatric and adult South African patients failing antiretroviral therapy. ARHR, 2008