<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2236Pol 2236Pol Cameroon 1995 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20R, E35D, M36I, R41K, H69K, K70R, L89M  
>2236Pol| codons 1-99
PQITLWQRPLVTVRIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Tscherning-Casper, C Evidence of the existence of a new circulating recombinant form of HIV type 1 subtype A/J in Cameroon. The European network on the study of in utero transmission of HIV-1. ARHR, 2000