<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4378 CA35259 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 44
2 3TC+AZT 26
3 3TC+AZT+IDV 48
4 3TC+D4T+NFV 31
5 NVP+RTV+SQV 72
6 3TC+ABC+APV+AZT+RTV 33
7 3TC+ABC+AZT+IDV+RTV 103
8 3TC+DLV+LPV+SQV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, M184V, T215TFIS K219Q   V179D K20R, V118I, K122E, I135T, G196E, F214L, L228LH, A272P, E297A  
>CA35259| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLSTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54V, V82A, L90M L10F, K43T, F53L, G73S I13V, I15V, G16A, N37D, K55R, L63P, A71V  
>CA34244| codons 1-99
PQITLWQRPFVTVKVAGQLKEALLDTGADDTILEEMDLPGRWTPKIVGGIGGLVRVRQYD
QIPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012