<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6839 CA35230 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 132
2 D4T+DDI+EFV 41
3 3TC+ABC+APV+RTV 57
4 DLV+EFV+LPV 70

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215CY   V106M V179E K122E, I135V, D177N, I178M, T200A, Q207E, V245T, E248D, A272P, K277R, E291D, E297K  
>CA35230| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNMEI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A   L10V, N37D, K43R, K55KR, R57K, I62V, L63P, A71V, I93L  
>CA34211| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWRPKIIGGIGGFVRVKQYD
QVPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012