<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14538 CA35183 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDI+NVP 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181I   A98S, S162SN, Q174R, T200A, E204D, R211G, E233D, I293V, E297EK, I329IL, R358RK, A376AT, E399ED, A400AT, E404ED, E432ED, V435I, L452LS, S468PT, Q480QE, S519SN, V531VI, A554AS  
>CA35183| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKRNPDIVI
IQYVDDLYVGSDLEIGQHRAKIEDLRQHLLGWGFTTPDKKHQKEPPFLWMGYDLHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWDTWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKSGKAGYVTDRGRQKVVTLTDTTNQKTELE
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKIYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35Q, N37D, R57RK, L63P, A71V, I72V, V77I, I93L  
>CA34168| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEQMDLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKVVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005