<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7988 CA35156 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 83
2 D4T+DDI+NFV 196
3 DDI+EFV+LPV 35
4 DDI+LPV+NVP 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V T215TI, K219Q K103N V108I, K238T K20R, V35IM, T39A, V60I, K64H, T69N, S105A, I135T, E138A, I202V, F214L, H221Y, L228H, T286A, I293V  
>CA35156| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAEMEKEGKISKIGPENPYNTPI
FAIHKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKAVTILDVGDAYFSVPL
DKDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGLITPDQKYQKEPPFHWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, L24I T12P, K14R, K20KR, L63P, A71V, I93L  
>CA34142| codons 1-99
PQITLWQRPFVPIRIGGQLREALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012