<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5481 CA35121 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 65
3 AZT+DDC+SQV 65
4 D4T+DDI+NFV+NVP 4
5 D4T+DDI+NFV 35
6 3TC+AZT+IDV+RTV 131
7 3TC+ABC+EFV 48
8 ABC+D4T+EFV 55

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, L210LW, T215F K219HQ Y188L   T39N, E44D, V60I, V118VI, K122E, I135L, T139I, I195IL, E203EK, Q207AE, L228H, K238X, K277R, T286A, E297K  
>CA35121| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNNEIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLELGQHRTKIKELRAHLWRWGFFTPDHKHQKEPPFHWMGYELHPDXWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GV, I54IT, V82VA   L10LI, N37NT, I62IV, I64V, A71AV, T74TS, V77VI  
>CA34106| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKMIVGIGGFTKVRQYD
QVLVEICGHKVIGSVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005