<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14671 CA35105 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 122
2 D4T+DDI+EFV 154

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y K219R K103N, Y181C, G190A V108VI K43KN, E44D, A98AS, V106VI, V118I, K122E, I135T, T200A, E203D, H221Y, L228LR, Q242QK, A272P, K277R  
>CA35105| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSITILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRAKIDELRQHLWRWGFYTPDRKYQKEPPFRWMGYELHPDKWT
VKPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13IV, I15V, E35D, M36I, N37NS, L63P, A71V, V75VI, V77VI, I93L  
>CA34096| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADNTVLEDISLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTILIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005