<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7071 CA35087 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 100
2 3TC+D4T 196
3 D4T+EFV+NFV 78
4 None 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML T215TN K103KN   V60VI, A98S, K102KR, K122X, D123DN, T139TR, I142IT, D177DG, R211K, K277KR, I293V  
>CA35087| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKRNKSVTVLDVGDAYFSVPL
DXNFRKYTAFTIPSINNERPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFNTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   K20X, E35D, N37D, D60E, L63P, H69Q, A71AV  
>CA34070| codons 1-99
PQITLWQRPLVTIKIGGQLXEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGQKVIGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005