<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8411 CA35072 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC 255

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, L210W, T215Y       K32KR, K43KE, R83RK, I135IV, S162CY, R211K, V245EK, A272P, K277R, I293V, V317A, G333E, Q334H, A360T, A376C, T377N, K390R, A400T, V435E, D460N, S468T, L469I, T470H, S519N, Q520K, K530R, A554N V35VGIR, N57NK, I142GV
>CA35072| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALREICTELEEEGKISKIGPENPYKTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQEHGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVKQLTEAVQKICNESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTIHDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNKIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSNGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, L63A, I64V, I72IV, I93L  
>CA34047| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIAVEICGHKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005