<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14651 CA35066 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 60

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108VI, P225H K20R, K102Q, K122E, I135T, S162SC, A272S, K277R, T286A, I293V  
>CA35066| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKALTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, I62V, L63P, H69HY, I72T  
>CA34061| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGYKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009