<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14602 CA35008 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 13
2 3TC+AZT+NFV 174
3 3TC+DDI+NFV+TDF 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I       V35VI, R83K, V90I, K122E, S162Y, K173E, R211RK, A272P, K277R, E297X  
>CA35008| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFREQNPDIVI
YQYIDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTXEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, R41K, L63P, I66M, K70R  
>CA33993| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEMCGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012