<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14589 CA34991 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+EFV 47
2 D4T+DDI+NVP 86

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, D67~   K103N, Y181C   K20R, L34I, T69S, D123E, V179I, T200TA, I202V, R211K, I293V S68D, E302D
>CA34991| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKAIVEICTEMEKEGKISKIGPENPYNTPV
FAIKRK~DSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLEIGQHRAKVEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L63P  
>CA33975| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005