<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6497 CA34983 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 52
2 3TC+D4T+IDV 182
3 3TC+D4T+NFV+NVP 95
4 ABC+D4T+RTV+SQV 121

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   G190A K101H T39A, E44D, V60VI, V118X, I135T, I142V, S162C, A272AP, K277R, Q278H, I293V  
>CA34983| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSXPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48GV, I54IV, V82A, I84IV, L90M L23LI, F53FL L10IV, M36I, R41RK, I62V, L63P, A71V, T74TS, I93L  
>CA33964| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVLEEINLPGKWKPKLIVGIGGLVKVRQYD
QVPIEICGHKVIGSVLVGPTPANVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005