<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14582 CA34975 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 65
2 D4T+ DDI+ NVP 47
3 ABC+ D4T+ IDV+ RTV 104
4 3TC+ AZT+ EFV 86

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, Q151M, M184V, L210W, T215Y V75M, F77L, N348IT G190A   V21VI, K43E, R83K, W88C, V90I, K101T, I135T, S162Y, T200I, V245E, A272AP, K277R, I293V, I329L, R356RK, G359S, A371AV, I375V, V381VI, V435E, D460N, R461K, S468N, Q509H, S519N, Q524E E302D
>CA34975| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDLRELNKKTQDFCEIQLGIPHPAGLTKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRIKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LDLAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKTLKTGKYAKMRSA
HTNDVKQLTEVVQKVATESIIIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKLGKAGYVTNKGRQKVVNLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAHPDKSESELVNQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, I62V, L63P, I72V, I93L  
>CA33960| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005