<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14153 CA34968 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 48
2 D4T 22
3 3TC+AZT 13
4 3TC+AZT+NVP 231
5 DDC+RTV+SQV 45
6 3TC+DDI+EFV+TDF 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184MV, L210W, T215Y A62AV K103N, V106A P225PH, F227FL V35L, T39A, K43E, E44D, R83K, K122E, D123E, S162X, D177E, I178L, G196E, R211K  
>CA34968| codons 1-275
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEEDGKISKIGPENPYNTPV
FVIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQXSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEHPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L63P  
>CA33953| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009