<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4317 CA34925 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 26
2 D4T+DDI+IDV 22
3 3TC+AZT+IDV 43
4 3TC+AZT+IDV+NFV+NVP 35
5 3TC+D4T+NFV 130
6 3TC+AZT+NFV 109

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y V75M, F77L     K43KE, E44D, V118I, D123E, I135L, I142V, S162SN, Q174HN, V179I, T200A, Q207E, R211K, L228R, T286A, E297K  
>CA34925| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEDGKISKIGPENPYNTPV
FAIKKKDSDKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKHNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82T L24I L10I, T12P, K14KR, K20Q, M36I, N37D, L63P, I64IV, A71V, I93L  
>CA33910| codons 1-99
PQITLWQRPIVPIRIGGQLQEALIDTGADDTVLEEIDLPGRWKPKLIGGIGGFVKVRQYD
QIPVEICGHKVIGTVLVGPTPTNIIGRNLLTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, A23AV, L28I, S39C, I72V, S119P  
>CA124183| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMVSDFNIPPVVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGPN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005