<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12012013 12012013 Thailand 2011 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 67

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, Q151M, M184I A62AV, D67DG, V75VI Y181C V179E E6D, K11T, I31L, V35T, T39K, K43E, S68G, D121DE, K122E, D123S, K173I, Q174K, D177E, Q207A, R211S, H221Y, K223KT, V245E, T286A, V292I, I293V, E312T, I329V, G335D  
>12012013| codons 1-335
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKLKALTEICKEMEEEGKISKIGPENPYNTPV
FVIKRKGGTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
EESFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRIKNPEIEI
CQYIDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKYQTEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLIAEVQKQGQD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K20R, E21D, M36I, R41K, H69K, L89M, I93M  
>12012013| codons 1-99
PQITLWQRPIVTVKIGGQLRDALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQMGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016