<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14548 CA34918 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 3TC+AZT 35
3 3TC+AZT+IDV 13
4 3TC+AZT+RTV 35
5 3TC+AZT+NFV 78
6 D4T+DDI+EFV 178

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, T215Y   K103N, Y181C, G190A A98G, V108I T7TA, V35M, T39X, K43KE, E44D, I50IV, W88WC, K122KE, D123E, R172RK, D177E, I178L, V189VI, G196E, E203K, Q207E, H208Y, R211K, A272P, V276T, K277R, I293V, E297K K223D
>CA34918| codons 1-301
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKIKALMEICXELEEDGKISKVGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFCEVQLGIPHPGGLKKNKSVTILDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPELVI
CQYMDDLYIASDLEIEQHRTKIKELREYLLKWGFYTPDKKHQDEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTRQLCKLLRGTKALTEVVPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V   K20I, E34Q, M36MI, K43KR, K45R, I62V, L63P, A71V, I93L C95CY
>CA33903| codons 15-99
IGGQLIEALLDTGADDTVLQEINLPGRWRPRMIGGIGGFIKVRQYDQVPIEICGHKVIGT
VLVGPTPVNVIGRNLLTQLGYTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005