<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
21032004 21032004 Nigeria 2010 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 FTC+NVP+TDF 122

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70E, M184V D67G K101E, Y181C, G190A   K11Q, V35K, V60VI, S68G, V90I, L109I, K122KE, D123N, K173T, Q174K, D177E, I178M, V179M, T200A, Q207E, H221Y, V245Q, E248N, D250E, S251N, A272P, T286A, E291D, V292I, I293V, D324E, I329V, Q334L, G335D  
>21032004| codons 1-335
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKALKEICTEMEKEGKISKIGPENPYNTPI
FAIKKKGGTEWRKLVDFRELNKRTQDFWEIQLGIPHPAGLEKKKSVTVIDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMMI
CQYVDDLYVASDLEIGQHRAKIEELREHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPNKENWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQGLD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, I13V, K14R, I15V, K20I, E35Q, M36I, R41K, R57K, I62V, L63P, C67E, H69K, V82I, L89M  
>21032004| codons 1-99
PQITLWQRPLVNVRVGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
QVPIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016