<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9935 CA34917 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 17
2 3TC+AZT 70
3 D4T+DDC+NVP 26
4 3TC+D4T+NFV 178
5 D4T+DDI+EFV+NFV 18
6 D4T+EFV+NFV+TDF 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219E Y181C, G190S   K49R, K101Q, T200A, Q207A, R211K, A272P, V276I, A288T, I293V K166H
>CA34917| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTHILEPFRKQNPDIVI
CQYMDDLYVSSDLEIGQHRAKIEELRAHLLKWGFITPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGTKTLTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D K14R, I15V, K20T, E35D, M36I, N37S, R41K, L63P, K70KR, V75VI  
>CA33902| codons 1-99
PQITLWQRPLVTIRVGGQLTEALLDTGADNTVLEDISLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHRAIGTILVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005