<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16012043 16012043 India 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 307

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215FS K219Q V106M, G190A F227L P4S, V35T, T39D, S48T, V60I, T69N, D121Y, K122E, D123DE, S162A, K173AT, D177E, V179I, T200E, E203K, Q207E, H208HY, R211K, L228H, V245Q, A272P, E291D, V292I, I293V, P321S, G335D  
>16012043| codons 1-335
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDELEKEGKITKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
YEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIII
YQYVDDLYVASDLEIGQHREKIKELREYLLKWGFSTPDQKHQKEPPLHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDSSKDLIAEIQKQGQD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, L19T, M36L, R41K, L63A, H69K, L89M, I93L  
>16012043| codons 1-99
PQITLWQRPLVTIKVEGQTKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016