<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14542 CA34907 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 139
2 DDC+ AZT 8
3 D4T 69
4 AZT+ 3TC 8
5 RTV+ AZT+ 3TC 17
6 IDV+ AZT+ 3TC 121
7 NVP+ DDI+ ABC 17
8 3TC+ TDF+ D4T+ ABC 170

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q K103S, G190A A98G A33G, V118I, T200TA, R211K, F214L, L228X, A272P, I293V  
>CA34907| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKGLVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKSKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRAKIEELRQHLLKWGLFTPDQKHQKEPPFXWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, I64V  
>CA33892| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005