<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
20012031 20012031 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 123

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108I, P225PH E6A, V35T, T39E, K64KR, K102HQ, K122E, D123S, Q145H, K173T, D177E, I178M, T200A, Q207E, R211K, H221HY, V245Q, E248D, D250E, A272P, T286A, V292I, I293V, E297A, P321PS P119PT
>20012031| codons 1-335
PISPIATVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTILDVGDAYFSVTL
DESFRKYTAFTIPSINNETPGIRYHYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKYQKEHPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDSSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, D60E, Q61E, H69K, L89M, I93L  
>20012031| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
EILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016