<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12021001 12021001 Thailand 2010 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 88

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DN, K70R, M184V T215I, K219E M230L V179D, Y318F E6D, K11S, K32KR, V35T, T39K, K46Q, E53G, K103R, K122E, D123N, K173L, Q174K, I178M, T200TA, I202V, Q207A, R211S, V245K, E248ED, A272P, E291D, V292I, I293V, E312T, I326V, I329V, G335D  
>12021001| codons 1-335
PISPIDTVPVSLKPGMDGPKVKQWPLTEEKIRALTEICKEMEKEGQISKIGPGNPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPDMDI
YQYVDDLYVGSDLEIGQHRAKVEELRAHLLSWGFITPDEKHQKEPPFLWLGYELHPDKWT
VQPIKLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKTPVHGVFYDPSKDLVAEVQKQGQD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, L63I, H69K, L89M  
>12021001| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016