<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16011041 16011041 India 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V, T215Y V75VIM, K219E K101KE, V106M E138K, F227L V35T, E36A, T39D, V60I, D121Y, K122E, D123E, I135R, S162A, K173T, D177E, T200A, E203EK, Q207E, V245Q, A272P, K277R, R284RK, T286A, E291D, V292I, I293V, G335D  
>16011041| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
YEEFRKYTAFTIPSRNNKTPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLLRWGFYTPDEKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLKGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14KR, L19I, M36I, R41K, Q61E, L63P, H69K, L89M, I93L  
>16011041| codons 1-99
PQITLWQRPLVSIRIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016