<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
20022030 20022030 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   K101E, V106M F227L K20R, E28G, V35T, V60I, K122E, D123S, K173A, Q174K, D177E, T200A, Q207E, R211K, L228R, V245Q, A272P, V276VI, K277R, L283I, E291D, V292I, I293V, V317A, G335GD  
>20022030| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTGEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPLRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, Q18H, L19I, K20R, M36I, R41K, L63C, H69K, I93L  
>20022030| codons 1-99
PQITLWQRPLVSIKVGGHIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Lam, EP Antiretroviral resistance after first-line antiretroviral therapy failure in diverse HIV-1 subtypes in the SECOND-LINE study. ARHR, 2016